| PDBID: | 9n4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7w | | Status: | HPUB -- hold until publication | | Title: | Extended and wrapped protein P7 dimers of dimers, the P1 layer and the RNA-dependent RNA polymerase P2 in transcribing particles of bacteriophage phi6 | | Authors: | Kumpula, E.-P., Ilca, S.L., Huiskonen, J.T. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i80 | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with a tolcapone derivative glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9i7y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of KRasG13C in Complex with Nucleotide-based Covalent Inhibitor 7b | | Authors: | Niggenaber, J., Mueller, M.P., Rauh, D. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7z | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with 2-fluoro non-carbohydrate glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9ls6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9ls5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4e | | Status: | HPUB -- hold until publication | | Title: | Structure of AG2-G02 Fab in complex with influenza H3N8 A/Mallard/Alberta/362/2017 Hemagglutinin | | Authors: | Gopal, A.B., Wu, N.C., Lv, H., Pholcharee, T. | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n4h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n4d | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Candida albicans pH regulated antigen 1 (Pra1) protein in complex with Zn2+ | | Authors: | Syrjanen, J.L., Perera, R.L. | | Deposition date: | 2025-02-02 | | Release date: | 2026-02-02 |
|
| PDBID: | 9n4f | | Status: | HPUB -- hold until publication | | Title: | Structure of 240-14-IgA_2F02 Fab in complex with influenza H3N8 A/Mallard/Alberta/362/2017 Hemagglutinin | | Authors: | Gopal, A.B., Wu, N.C., Lv, H., Pholcharee, T. | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n46 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n4b | | Status: | HPUB -- hold until publication | | Title: | RhoA GTPase R70A bound to GTPgammaS | | Authors: | Marcus, K., Mattos, C. | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n4c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-02 |
|
