PDBID: | 9g0i | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0o | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus borealis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0p | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus laevis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0q | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0r | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 4-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus tropicalis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0t | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus tropicalis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0l | Status: | HPUB -- hold until publication | Title: | Crystal structure of the RING-ZnF1 fragment of SIAH1 | Authors: | Coste, F., Suskiewicz, M.J. | Deposition date: | 2024-07-08 | Sequence: | >Entity 1 MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH
|
|
PDBID: | 9g0n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 299K | Authors: | Daniel, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0u | Status: | HPUB -- hold until publication | Title: | Human LTC4 synthase in complex with AZD9898 | Authors: | Srinivas, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0v | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human LTC4 synthase in complex with compound 1 | Authors: | Srinivas, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9inv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of DAPK1 in complex with isoliquiritigenin | Authors: | Yokoyama, T. | Deposition date: | 2024-07-08 |
|
PDBID: | 9ioc | Status: | AUTH -- processed, waiting for author review and approval | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Single Ring) | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | D-Amino Acid Substituted Antimicrobial Peptides Derived from Tilapia piscidin 4 | Authors: | Huang, Y.P., Chang, C.F. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Tilapia Piscidin-TP2-5 | Authors: | Huang, Y.P., Chang, C.F. | Deposition date: | 2024-07-08 |
|
PDBID: | 9inu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Novel PD-L1/VISTA dual inhibitor as potential immunotherapy agents | Authors: | Cheng, Y., Xiao, Y.B. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io5 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of dimeric F1-like ATPase from Mycoplasma mobile gliding machinery | Authors: | Toyonaga, T., Kato, T., Kawamoto, A., Miyata, T., Kawakami, K., Fujita, J., Hamaguchi, T., Namba, K., Miyata, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9inn | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-08 |
|
PDBID: | 9ino | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-08 | Release date: | 2025-07-08 |
|
PDBID: | 9ioa | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-08 |
|
PDBID: | 9iob | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of hexameric DRT9-ncRNA complex | Authors: | Zhang, J.T., Song, X.Y., Wei, X.Y., Jia, N. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SME-1 Carbapenemase in complex with Nacubactam. | Authors: | Dhankhar, K., Hazra, S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SME-1 Carbapenemase in complex with Zidebactam | Authors: | Dhankhar, K., Hazra, S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9inr | Status: | HPUB -- hold until publication | Title: | Crystal structure of PIN1 in complex with inhibitor C3 | Authors: | Zhang, L.Y. | Deposition date: | 2024-07-08 |
|
PDBID: | 9iny | Status: | PROC -- to be processed | Title: | Structure of bacteriophage T5 tail tube | Authors: | Peng, Y.N., Liu, H.R. | Deposition date: | 2024-07-08 |
|