| PDBID: | 9fd9 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcv | | Status: | HPUB -- hold until publication | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fda | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd7 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of vibrio cholerae phage VP1 capsid protein | | Authors: | Liu, H.R., Pang, H. | | Deposition date: | 2024-05-16 | | Release date: | 2025-05-16 |
|
| PDBID: | 8zkb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of dinucleosome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zke | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure ofAnhydromuropeptide permease (AmpG) complex with GlcNAc-1,6-anhMurNAc | | Authors: | Chang, N., Kim, U., Yoo, Y., Kim, H., Cho, H. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkj | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of apo-LDHC | | Authors: | Wu, C.Y., Wang, H.L. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zki | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zkh | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-16 | | Release date: | 2025-05-16 |
|
| PDBID: | 8zkf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of AAV2 Rep68 bound to integration site AAVS1: Insights into the mechanism of DNA melting. | | Authors: | Escalante, C.R. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GPPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
>Entity 2
(DG)(DT)(DT)(DG)(DG)(DG)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DT)(DC)(DG)(DC)(DT)(DC)
>Entity 3
(DG)(DA)(DG)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DC)(DC)(DC)(DA)(DA)(DC)
|
|
| PDBID: | 9bu4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435W, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu9 | | Status: | HPUB -- hold until publication | | Title: | Mixed-valent (2/3) dimanganese SfbO | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bua | | Status: | HPUB -- hold until publication | | Title: | SfbO reconstituted with Mn(II) anaerobically | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bub | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
