| PDBID: | 9gby | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-07-31 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
| PDBID: | 9gbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxt | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin A/Hong Kong/1/68 produced in GnTI- cells | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxu | | Status: | HPUB -- hold until publication | | Title: | Endo H-treated hemagglutinin A/Hong Kong/1/68 | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxb | | Status: | HPUB -- hold until publication | | Title: | Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly | | Authors: | Jia, Z., Ryan, H., Colleen, N. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxe | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 Spike protein Ectodomain with internal tag, all RBD-down conformation -C1 | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxr | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystallographic Structure of the Poly(Hexamethylene Adipamide) (Nylon66) Hydrolase Nyl50 at Room Temperature | | Authors: | Meilleur, F., Williams, A.N., Drufva, E.E., Parks, J.M., Chen, S.H., Michener, J.K. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 FC WT at pH 5.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
