PDBID: | 9goh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-05 |
|
PDBID: | 9gon | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of DPP9 in complex with sulphostin | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | Deposition date: | 2024-09-05 |
|
PDBID: | 9goc | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of DPP9 Ser730Ala in complex with sulphostin. | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | Deposition date: | 2024-09-05 |
|
PDBID: | 9go8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-05 |
|
PDBID: | 9god | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of DPP9 in complex with N-phosphono-(S)-3-aminopiperidine-2-one-based inhibitor | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | Deposition date: | 2024-09-05 |
|
PDBID: | 9goe | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-05 |
|
PDBID: | 9goj | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-05 |
|
PDBID: | 9gog | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with furan-2-carboxylic acid (3-ethoxy-2-hydroxybenzylidene)hydrazide | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | Deposition date: | 2024-09-05 |
|
PDBID: | 9gob | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-05 |
|
PDBID: | 9gol | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of limonene epoxide hydrolase LEH 19 | Authors: | Levy, C.W. | Deposition date: | 2024-09-05 |
|
PDBID: | 9gok | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with (E)-N''-(1-(2-hydroxy-5-methoxyphenyl)ethylidene)furan-2-carbohydrazide) | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | Deposition date: | 2024-09-05 |
|
PDBID: | 9gom | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of limonene epoxide hydrolase LEH 31 | Authors: | Levy, C.W. | Deposition date: | 2024-09-05 |
|
PDBID: | 9goo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human carbonic anhydrase II in complex with PCI-27483 | Authors: | Angeli, A., Ferraroni, M. | Deposition date: | 2024-09-05 |
|
PDBID: | 9gop | Status: | HPUB -- hold until publication | Title: | Crystal structure of CDK2-cyclin E1 bound by 2-[(2S)-1-(9-ethyl-6-{[1-methyl-3-(methylsulfonyl)-1H-pyrazol-5-yl]amino}-9H-purin-2-yl)-4,4-difluoro-2-pyrrolidinyl]-2-propanol. | Authors: | Collie, G.W. | Deposition date: | 2024-09-05 |
|
PDBID: | 9gof | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-05 | Sequence: | >Entity 1 MQSEQWRSLSNVVWGKDLPAFTYAFSKTPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRITLTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWLSHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLLGQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMDLTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLASNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP
|
|
PDBID: | 9jfs | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-05 |
|
PDBID: | 9jg3 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-05 |
|
PDBID: | 9jfy | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-05 |
|
PDBID: | 9jg0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-05 |
|
PDBID: | 9jfx | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-05 |
|
PDBID: | 9jfq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Resembled the partial R-loop state with the PAM-distal spacer forming a base-pair interaction with the TS | Authors: | Zhang, S., Liu, J. | Deposition date: | 2024-09-05 |
|
PDBID: | 9jfo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Areconstituted LaTraC ternary complex with a full R-loop | Authors: | Zhang, S., Liu, J. | Deposition date: | 2024-09-05 |
|
PDBID: | 9jfp | Status: | AUTH -- processed, waiting for author review and approval | Title: | Areconstituted LaTraC ternary complex with a full R-loop | Authors: | Zhang, S., Liu, J. | Deposition date: | 2024-09-05 |
|
PDBID: | 9jg1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Adriforant-bound Histamine receptor 4 H4R at inactive state | Authors: | Jin, S.S., Zhang, H., Jiang, Y. | Deposition date: | 2024-09-05 | Release date: | 2025-09-05 |
|
PDBID: | 9jg2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs | Authors: | Dong, H., Shen, C., Tang, X., Qiao, W. | Deposition date: | 2024-09-05 |
|