| PDBID: | 8wzw | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S/C393S/D394N | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-11-02 | | Release date: | 2024-12-02 |
|
| PDBID: | 8x00 | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S/C393S/D394C | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-11-02 | | Release date: | 2024-12-02 |
|
| PDBID: | 8r1e | | Status: | HPUB -- hold until publication | | Title: | crystal structure of acyl-CoA dehydrogenase FadE2 mutant (PA0508 M130G E296A Q303A) from Pseudomonas aeruginosa | | Authors: | Wang, M., Brear, P., Welch, M. | | Deposition date: | 2023-11-01 | | Release date: | 2025-05-01 |
|
| PDBID: | 8r0w | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 5-bromobenzo[d]oxazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0y | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 3-((3-hydroxyphenyl)amino)quinoxaline-2-carboxylic acid and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r13 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Alpha-1-antitrypsin (Met374Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uui | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-01 | | Release date: | 2025-05-01 |
|
| PDBID: | 8uuj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 | | Release date: | 2025-04-23 |
|
| PDBID: | 8uur | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nAb 5B11 | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nAb 5B11 (localized refinement) | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 sc9-10 strain: B18537) in complex with humanized nAb 5B11 | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz9 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and adenine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz0 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 3CLpro bound to covalent inhibitor | | Authors: | Peng, J., Sun, D., Ding, X. | | Deposition date: | 2023-11-01 | | Release date: | 2025-05-01 |
|
| PDBID: | 8wz6 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and DZNep | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(I255A,T287A) in ternary complex with NAD and adenosine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz8 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(T67A,Q69A) complex with NAD | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wza | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in nanodisc | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uut | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uus | | Status: | HPUB -- hold until publication | | Title: | Structure of Serratia proteamaculans antifeeding prophage Fibre foot domain (AfpX13) | | Authors: | Young, P.G., Hurst, M.R.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8uuc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 | | Release date: | 2025-04-30 |
|
| PDBID: | 8uud | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8r0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
| PDBID: | 8r0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
| PDBID: | 8r0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
