| PDBID: | 9fcq | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H122A mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHALEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcs | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H122N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHNLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcu | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121A mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIAHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGSC
|
|
| PDBID: | 9fcn | | Status: | HPUB -- hold until publication | | Title: | OPR3 loop swap variant L6(AchrOYE4) in complex with NADPH4 | | Authors: | Bijelic, A., Kerschbaumer, B., Macheroux, P. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
MASHHHHHHMASSAQDGNNPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRATAGGFLITEGTMISPTSAGFPHVPGIFTKEQVREWKKIVDVVHAKGAVIFCQLWHVGRASHEVYQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGADRVGVRVSPAIDHLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTAEADWDDAPDMPEEEEARLMRTLRNAYQGTFICSGGYTRELGIEAVAQGDADLVSYGRLFISNPDLVMRIKLNAPLNKYNRKTFYTQDPVVGYTDYPFLQGNGSNGPLSRL
|
|
| PDBID: | 9fc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcg | | Status: | HPUB -- hold until publication | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with PrFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zk0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zk3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of nucleosome-bound RFX5 complex -asterisk | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of hexasome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of dinucleosome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of dinucleosome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zk1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of YF24228-bound porcine bc1 complex | | Authors: | Yang, G.-F., Wang, Y.-X., Dong, J.Q. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of free nucleosome | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zju | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of free nucleosome asterisk | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zk6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Decarboxylase KDC4427 from Enterobacter sp. CGMCC 5087 | | Authors: | Dong, S., Liu, L., Zhang, H. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8zk7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L from Enterobacter sp. CGMCC 5087 | | Authors: | Dong, S., Liu, L., Zhang, H. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8zk8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L in complex with indole-3-pyruvic acid | | Authors: | Dong, S., Liu, L., Zhang, H. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8zk9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L in complex with phenylpyruvic acid | | Authors: | Dong, S., Liu, L., Zhang, H. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8zka | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Decarboxylase KDC4427 in complex with phenylpyruvic acid intermediate | | Authors: | Dong, S., Liu, L., Zhang, H. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
