| PDBID: | 9b2o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2m | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin H1 New Caledonia 1999 in complex with monoclonal antibody Fab 43_S0008 | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B., Ataca, S., Kanekiyo, M. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NAD+ | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 9b2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NADH | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 9b2q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Pantothenate Synthetase from Candida albicans. | | Authors: | Regan, J., Avad, K.A., Alaidi, O., Seetharaman, J., Palmer, G.E., Hevener, K.E. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2e | | Status: | HPUB -- hold until publication | | Title: | DHNA associated with an inhibitor | | Authors: | Czeczot, A.M., Silva, E.E.D., Timmers, L.F.S.M., Machado, P., Basso, L.A., Bizarro, C.V. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2k | | Status: | HPUB -- hold until publication | | Title: | SpCas9 with dual-guide RNA in open conformation | | Authors: | Korolev, S., Gagnon, K. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eov | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eos | | Status: | HPUB -- hold until publication | | Title: | Human serum albumin with myristate | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLL
|
|
| PDBID: | 9eol | | Status: | HPUB -- hold until publication | | Title: | N-acetylglucosamine 6-phosphate dehydratase: inhibited 6-phosphogluconic acid state of NagS | | Authors: | McNae, I.W., Abrahams, J.P., Li, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eot | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eok | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp8 | | Status: | HOLD -- hold until a certain date | | Title: | Structural and mechanistic insights into the allosteric activation of p38alpha MAP kinase via specific docking interactions | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-15 | | Release date: | 2025-03-15 |
|
| PDBID: | 8yp6 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM map of 30S ribosomal subunit in complex with MetAP1c of Mycobacterium smegmatis | | Authors: | Banerjee, A., Srinivasan, K., Sengupta, J. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp9 | | Status: | HPUB -- hold until publication | | Title: | the crystal structure of wildtype Magnaporthe grisea oxidoreductase in complex with NADP | | Authors: | Huang, X., Jiang, H., Tang, D., Lin, S. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glucosyltransferase RrUGT3 | | Authors: | Cai, Y. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp4 | | Status: | HPUB -- hold until publication | | Title: | Structure of MAP2K1 complexed with 5Z7-oxozeaenol | | Authors: | Yumura, S., Kinoshita, T. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yp5 | | Status: | HPUB -- hold until publication | | Title: | The structure of MAP2K4 complexed with 5Z7-oxozeaenol | | Authors: | Yumura, S., Kinishita, T. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b23 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | WT strain WT mycobacterial ribosome | | Authors: | Chen, Y., Young, I.D., Fraser, J.S., Javid, B. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b24 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | WT strain gidB mutant mycobacterial ribosome | | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HWS19 strain WT mycobacterial ribosome | | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | | Deposition date: | 2024-03-14 |
|
