PDBID: | 8xr0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of AtHPPD-YH21618 complex | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | Deposition date: | 2024-01-05 |
|
PDBID: | 8xqv | Status: | HPUB -- hold until publication | Title: | Crystal structure of AtHPPD-YH23025 complex | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | Deposition date: | 2024-01-05 |
|
PDBID: | 8xqc | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8rm8 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-05 | Release date: | 2025-01-05 |
|
PDBID: | 8rm4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8rmc | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-05 |
|
PDBID: | 8rmd | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8rme | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8rm9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-05 | Release date: | 2025-01-05 |
|
PDBID: | 8rma | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8rmf | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8rmb | Status: | HPUB -- hold until publication | Title: | Erk2 MAP kinase (R65S+T188D) double mutant | Authors: | Livnah, O., Gutman, D. | Deposition date: | 2024-01-05 |
|
PDBID: | 8rmg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vin | Status: | AUTH -- processed, waiting for author review and approval | Title: | Superfolder Green Fluorescent Protein with 2-cyano-L-phenylalanine at the chromophore (position 66) | Authors: | Kirsh, J.M., Bagheri, N., Boxer, S.G. | Deposition date: | 2024-01-05 |
|
PDBID: | 8viw | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of heparosan synthase 2 from Pasteurella multocida with polysaccharide in the GlcNAc-T active site | Authors: | Krahn, J.M., Pedersen, L.C., Liu, J., Stancanelli, E., Borgnia, M., Vivarette, E. | Deposition date: | 2024-01-05 |
|
PDBID: | 8vix | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8viv | Status: | HPUB -- hold until publication | Title: | Crystal structure of FBF-2 RBD in complex with gld-1 FBEa* RNA | Authors: | Qiu, C., Hall, T.M.T. | Deposition date: | 2024-01-05 |
|
PDBID: | 8viy | Status: | HPUB -- hold until publication | Title: | 15-Lipoxygenase-2 V427L | Authors: | Gilbert, N.C., Offenbacher, A.R., Ohler, A.R.L. | Deposition date: | 2024-01-05 |
|
PDBID: | 8vio | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vip | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8viq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vir | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vit | Status: | HPUB -- hold until publication | Title: | Crystal structure of the N-terminal domain of fatty acid kinase A (FakA) from Staphylococcus aureus (Mg and ADP) | Authors: | Lovell, S., Kashipathy, M.M., Battaile, K.P., Bose, J.L. | Deposition date: | 2024-01-05 |
|
PDBID: | 8viz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-05 |
|
PDBID: | 8vj0 | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Oxidized Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-05 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|