PDBID: | 8xto | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment L18-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 LGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 8xtn | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 8xtu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Rab5b GTPase domain from Leishmania donovani in complex with GDP | Authors: | Zohib, M., Pal, R.K., Biswal, B.K., Arora, A. | Deposition date: | 2024-01-11 |
|
PDBID: | 8xtr | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of the intron 3 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|
PDBID: | 8xtp | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of intron 4 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|
PDBID: | 8xts | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of intron 1 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|
PDBID: | 8xtv | Status: | HPUB -- hold until publication | Title: | Crystal structure of AaHPPD-Y14150 complex | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | Deposition date: | 2024-01-11 |
|
PDBID: | 8xtq | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of intron 2 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|
PDBID: | 8roc | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8rod | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8roe | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8rog | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8roh | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8roj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8roi | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8rok | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8rol | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8ro2 | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-01-11 |
|
PDBID: | 8rnz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8ro4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|
PDBID: | 8ro5 | Status: | HPUB -- hold until publication | Title: | HLA-A3 restricted mG12V-TCR | Authors: | Sim, M.J.W., Sun, P.D. | Deposition date: | 2024-01-11 |
|
PDBID: | 8ro3 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of the staked Photosystem II - LHCII supercomplex from Chlorella ohadi | Authors: | Fadeeva, M., Klaiman, D., Caspy, I., Nelson, N. | Deposition date: | 2024-01-11 |
|
PDBID: | 8ro0 | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-01-11 |
|
PDBID: | 8ro1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the C. elegans Intron Lariat Spliceosome primed for disassembly (ILS'') | Authors: | Vorlaender, M.K., Rothe, P., Plaschka, C. | Deposition date: | 2024-01-11 |
|
PDBID: | 8ro6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-11 |
|