PDBID: | 9j0j | Status: | HPUB -- hold until publication | Title: | The crystal structure of Fe/2OG-dependent oxygenase DfmD | Authors: | Wang, L., Chen, J., Zhou, J. | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0d | Status: | HPUB -- hold until publication | Title: | Apo structure of ketoreductase AsuC7 from Asukamycin polyketide Synthases | Authors: | Dai, Y., Qu, X. | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0c | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0a | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0e | Status: | HPUB -- hold until publication | Title: | Catalyst-free photoinitiated intramolecular carbon-carbon coupling enables the efficient synthesis of pharmaceutically important biaryls | Authors: | Yang, L., Qu, X.D. | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0s | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0q | Status: | HPUB -- hold until publication | Title: | Structure of mEos3.2 in the green fluorescent state | Authors: | Zheng, S.P. | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0t | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-08-02 | Release date: | 2025-08-02 |
|
PDBID: | 9cyv | Status: | HPUB -- hold until publication | Title: | Structure of the Thermococcus sibiricus NfnABC complex | Authors: | Xiao, X., Li, H. | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyw | Status: | HPUB -- hold until publication | Title: | Structure of the NAD(H)-bound Thermococcus sibiricus NfnABC complex | Authors: | Xiao, X., Li, H. | Deposition date: | 2024-08-02 |
|
PDBID: | 9cye | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyf | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyg | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyh | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyi | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyd | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyk | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyn | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 | Sequence: | >Entity 1 GSGSMELRSITVESWDNPAASAAYGWEVFTDKDTQQAQGAQPQAYQPVAQNAQSLREVKLIAGKPGDIKNVDAGTAKVLGVKFQFTYPGDNSVTIRPPRVPEYEVLRTKSYLDANNQRKVSKIYGVEFPGVSKAISVWV(YCM)GRGNEYNLEGWIEDWKGDTHILQFGSLDFIGWRPLTVGIPQGVPQDVNSYPQVKTIVFKQFKIRSRPDTSGETVYLFFDELRVLSDVFEVHFDGASIDFDDEDCKSKHKLDKMLKTK
|
|
PDBID: | 9cyt | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyx | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyu | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9cyj | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9j02 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0b | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-02 |
|
PDBID: | 9j0g | Status: | HPUB -- hold until publication | Title: | Crystal structure of RhoA-TP1001 complex | Authors: | Zhu, L., Li, H., Chang, L., Hu, X. | Deposition date: | 2024-08-02 |
|