| PDBID: | 9g0m | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K | | Authors: | Horvath, D. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0j | | Status: | HPUB -- hold until publication | | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) from Geobacillus thermodenitrificans | | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0g | | Status: | HPUB -- hold until publication | | Title: | BsCdaA in complex with Compound 7 | | Authors: | Neumann, P., Ficner, R. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0q | | Status: | HPUB -- hold until publication | | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0r | | Status: | HPUB -- hold until publication | | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 4-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0s | | Status: | HPUB -- hold until publication | | Title: | Xenopus tropicalis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0t | | Status: | HPUB -- hold until publication | | Title: | Xenopus tropicalis undecorated microtubule - 15 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0n | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 299K | | Authors: | Horvath, D. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the RING-ZnF1 fragment of SIAH1 | | Authors: | Coste, F., Suskiewicz, M.J. | | Deposition date: | 2024-07-08 | | Sequence: | >Entity 1
MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH
|
|
| PDBID: | 9g0u | | Status: | HPUB -- hold until publication | | Title: | Human LTC4 synthase in complex with AZD9898 | | Authors: | Srinivas, H. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human LTC4 synthase in complex with compound 1 | | Authors: | Srinivas, H. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0o | | Status: | HPUB -- hold until publication | | Title: | Xenopus borealis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0p | | Status: | HPUB -- hold until publication | | Title: | Xenopus laevis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9inq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9io4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Biotin Carboxylase-Biotin Carboxyl Carrier Protein Complex (Single Ring; C2) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9inl | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease E166R mutant in complex with Bofutrelvir | | Authors: | Zhou, X.L., Li, J. | | Deposition date: | 2024-07-08 | | Release date: | 2025-07-08 |
|
| PDBID: | 9inm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of MERS main protease in complex with Bofutrelvir | | Authors: | Wang, W.W., Zhou, X.L., Wang, Q.S., Li, J. | | Deposition date: | 2024-07-08 | | Release date: | 2025-07-08 |
|
| PDBID: | 9inv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DAPK1 in complex with isoliquiritigenin | | Authors: | Yokoyama, T. | | Deposition date: | 2024-07-08 | | Sequence: | >Entity 1
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSLEHHHHHH
|
|
| PDBID: | 9inw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DAPK1 in complex with compound 9 | | Authors: | Yokoyama, T. | | Deposition date: | 2024-07-08 | | Sequence: | >Entity 1
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSLEHHHHHH
|
|
| PDBID: | 9inx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DAPK1 in complex with compound 10 | | Authors: | Yokoyama, T. | | Deposition date: | 2024-07-08 | | Sequence: | >Entity 1
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSLEHHHHHH
|
|
| PDBID: | 9inz | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx43/GJA1 gap junction intercellular channel bound to carbenoxolone | | Authors: | Lee, C.W. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9io1 | | Status: | HOLD -- hold until a certain date | | Title: | INTERACTION BETWEEN A FLUOROQUINOLONE DERIVATIVE KG022 AND RNAS: EFFECT OF BASE PAIRS 5'' ADJACENT TO THE BULGE OUT RESIDUES | | Authors: | Ichijo, R., Kawai, G. | | Deposition date: | 2024-07-08 | | Release date: | 2025-07-08 |
|
| PDBID: | 9io0 | | Status: | HOLD -- hold until a certain date | | Title: | INTERACTION BETWEEN A FLUOROQUINOLONE DERIVATIVE KG022 AND RNAS: EFFECT OF BASE PAIRS 5'' ADJACENT TO THE BULGE OUT ESIDUES | | Authors: | Ichijo, R., Kawai, G. | | Deposition date: | 2024-07-08 | | Release date: | 2025-07-08 |
|
