PDBID: | 9c6a | Status: | HPUB -- hold until publication | Title: | The CRISPR associated adenosine deaminase Cad1-CARF in the apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c69 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c68 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c63 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c64 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c65 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 | Sequence: | >Entity 1 STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
PDBID: | 9c6b | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c67 | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6h | Status: | HPUB -- hold until publication | Title: | [d3] Tensegrity triangle with deazapurine center strand (strand 3) in R3 | Authors: | Vecchioni, S., Sha, R., Ohayon, Y., Galindo, M., Lopez-Chamorro, C., Jong, M. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6i | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6c | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (symmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6j | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6e | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6f | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (Asymmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6k | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6g | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Mcm double hexamer from human | Authors: | Liu, C., Xu, N., Lin, Q. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6o | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Multiple independent acquisitions of ACE2 usage in MERS-related coronaviruses | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Diseases, Veesler, D., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | Deposition date: | 2024-06-07 |
|
PDBID: | 9fmg | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9fmo | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9fmp | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9fmf | Status: | HPUB -- hold until publication | Title: | KlenTaq DNA polymerase in a ternary complex with primer/template and a fluorobenzofuran-modified dUTP (FBFdUTP) | Authors: | Betz, K., Srivatsan, S.G. | Deposition date: | 2024-06-06 |
|
PDBID: | 9fmj | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9fmk | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9fml | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9fmq | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|