PDBID: | 8jw2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-28 | Release date: | 2024-12-28 |
|
PDBID: | 8tbc | Status: | HPUB -- hold until publication | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | Deposition date: | 2023-06-28 | Release date: | 2024-12-28 |
|
PDBID: | 8tbb | Status: | HPUB -- hold until publication | Title: | F9S, novel TIM-3 targeting antibody, bound to IgV domain of TIM-3 | Authors: | Oganesyan, V., van Dyk, N., Mazor, Y., Yang, C. | Deposition date: | 2023-06-28 |
|
PDBID: | 8tb9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-28 | Release date: | 2024-12-18 |
|
PDBID: | 8pkn | Status: | HPUB -- hold until publication | Title: | CryoEM structure of catalytic domain of human HMG-CoA reductase with its inhibitor atorvastatin | Authors: | Manikandan, K., Van Rooyen, J. | Deposition date: | 2023-06-27 | Release date: | 2025-01-03 |
|
PDBID: | 8tac | Status: | HPUB -- hold until publication | Title: | Designed DNA binding protein | Authors: | Doyle, L., Stoddard, B.L., Glasscock, C.J., McHugh, R.P., Pecoraro, R.J. | Deposition date: | 2023-06-27 |
|
PDBID: | 8tas | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-27 | Release date: | 2024-12-18 |
|
PDBID: | 8jum | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-26 | Release date: | 2024-12-31 |
|
PDBID: | 8ta1 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Dihydrofolate reductase (DHFR) from Mycobacterium ulcerans Agy99 in complex with NADP and inhibitor MAM907 | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID) | Deposition date: | 2023-06-26 |
|
PDBID: | 8ta0 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Dihydrofolate reductase (DHFR) from Mycobacterium ulcerans Agy99 in complex with NADP and inhibitor MAM881 | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID) | Deposition date: | 2023-06-26 |
|
PDBID: | 8t9s | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-24 |
|
PDBID: | 8t8t | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal structure of TET25 in complex with PyDH2 ligand in P212121 space group | Authors: | Lam, G., Yatsunyk, L.A. | Deposition date: | 2023-06-23 |
|
PDBID: | 8t9g | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-23 | Release date: | 2024-12-18 |
|
PDBID: | 8pin | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pis | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pio | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pir | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8jtq | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8jtu | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-09-24 |
|
PDBID: | 8t8j | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-22 | Release date: | 2024-12-18 |
|
PDBID: | 8jti | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8pik | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8t7r | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8jsq | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-20 |
|