PDBID: | 7gy3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 7gxq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-09 |
|
PDBID: | 7gwk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 7gwl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 8xs8 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Benzo[a]pyrene | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xsr | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xss | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xsm | Status: | HPUB -- hold until publication | Title: | transporter | Authors: | Jiang, D.H., Wang, K. | Deposition date: | 2024-01-09 |
|
PDBID: | 8xsk | Status: | HOLD -- hold until a certain date | Title: | crystal structure of PPAT | Authors: | Yin, H.S. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8rmu | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8rmv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8rmt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk6 | Status: | HPUB -- hold until publication | Title: | Amide-linked, extended 14alpha-demethylase (CYP51) with antifungal azole inhibitor | Authors: | Tyndall, J.D.A., Monk, B.C., Simons, C. | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vjz | Status: | HPUB -- hold until publication | Title: | HLA-A*03:01 with WT KRAS-10mer | Authors: | Sim, M.J.W., Sun, P.D. | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8vk5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xs2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 | Sequence: | >Entity 1 MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2 MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
PDBID: | 8xs1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 8xrq | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | Authors: | Liu, C.C., Ju, B., Zhang, Z. | Deposition date: | 2024-01-08 |
|