| PDBID: | 9e8u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8r | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease T190I covalently bound to compound GRL-051-22 at 1.5 A | | Authors: | Beechboard, S.B., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-11-06 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQIAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9e8t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e91 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ec83 Retron PtuA Dimer bound to ATP | | Authors: | Rish, A.D., Wang, C., Fu, T.M. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e90 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ec83 Retron PtuA/PtuB (2-1) complex bound to ADP | | Authors: | Rish, A.D., Wang, C., Fu, T.M. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kff | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the compound 4-bound human relaxin family peptide receptor 3 (RXFP3)-Gi complex | | Authors: | Zhou, Q.T., Chen, Y., Wang, M.W. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the human relaxin family peptide receptor 3 in complex with relaxin-3 and G protein | | Authors: | Chen, Y., Zhou, Q.T., Wang, Y., Yan, J.H., Zhu, Q., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the relaxin-3-bound human relaxin family peptide receptor 4 (RXFP4)-Gi complex | | Authors: | Chen, Y., Zhou, Q.T., Wang, M.W. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfp | | Status: | HPUB -- hold until publication | | Title: | Proline engineered disulfide rich peptides | | Authors: | Liu, H.T. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfr | | Status: | HPUB -- hold until publication | | Title: | A multi cyclic peptide binding to TROP2 protein | | Authors: | Liu, H.T. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of A. vinelandii NifA GAF domain plus B-linker with 2-oxo | | Authors: | Zhang, W.Y., Zeng, J.W., Xiong, J.L., Wang, Y.F., Gao, Y., Duan, J.S., Zhou, L.H., Lan, H.Y., Mei, Z.Q., Wang, J.W., Wang, F. | | Deposition date: | 2024-11-06 | | Release date: | 2025-11-06 |
|
| PDBID: | 9kfq | | Status: | HPUB -- hold until publication | | Title: | Loop4 engineered disulfide-rich peptides | | Authors: | Liu, H.T. | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9kfh | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-06 | | Release date: | 2025-11-06 |
|
| PDBID: | 9kfs | | Status: | HPUB -- hold until publication | | Title: | A multi cyclic peptide binging to 4-1BB protein | | Authors: | Liu, H.T. | | Deposition date: | 2024-11-06 |
|
