| PDBID: | 9iii | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ZIKV-117 Fab | | Authors: | Zhao, H., Deng, Z. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9iic | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbu | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbw | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cby | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbx | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cbv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9cc5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9frl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fs0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frr | | Status: | HPUB -- hold until publication | | Title: | Caspase recruitment domain (CARD) | | Authors: | Dym, O., Amitai, G., Wein, T., Sorek, R. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fro | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pent - p-sulfonatocalix[6]arene complex | | Authors: | Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fru | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor and NAD+ | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frm | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of glycogen phosphorylase with an indole derivative | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2024-06-19 | | Sequence: | >Entity 1
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKI(CSO)GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK(CSO)QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP
|
|
| PDBID: | 9frt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from Pseudomonas fluorescens N3 | | Authors: | Milani, M. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frs | | Status: | HPUB -- hold until publication | | Title: | Human PARP10 ART domain bound to a phthalazinone-based inhibitor | | Authors: | Moche, M., Upadhyaya, K., Cohen, M.S., Schuler, H. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frq | | Status: | HPUB -- hold until publication | | Title: | Solution structure of Tx33.1 from Conus textile | | Authors: | Ellgaard, L., Khilji, M.S., Hackney, C.M., Teilum, K. | | Deposition date: | 2024-06-19 |
|
