| PDBID: | 9ytv | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9yty | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human p38 ALPHA MAPK:MW01-7-081aSRM inhibitor complex | | Authors: | Brunzelle, J.S., Shuvalova, L., Roy, S.M., Watterson, D.M. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1k | | Status: | PROC -- to be processed | | Title: | Ex vivo kappa-AL amyloid fibril (FOR1007) morphology I | | Authors: | Andreotti, G., Schmidt, M., Faendrich, M. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t14 | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t13 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Triple Stack Doxycycline Bound 50S Subunit of the Coxiella burnetii Ribosome | | Authors: | Stuart, W.S., Isupov, M.N., Harmer, N.J. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t19 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1a | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1p | | Status: | HPUB -- hold until publication | | Title: | Human PI3Kdelta in complex with IOA-288 | | Authors: | Graedler, U., Augustin, M., Goesser, C., Kiefersauer, R. | | Deposition date: | 2025-10-21 | | Sequence: | >Entity 1
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
>Entity 2
YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
|
|
| PDBID: | 9t17 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM reconstruction of the Kinesin KIF5A motor domain decorated GMPCPP microtubule | | Authors: | Munoz-Hernandez, H., Wieczorek, M. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM reconstruction of undecorated GDP microtubule | | Authors: | Munoz-Hernandez, H., Wieczorek, M. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t15 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human BRD4-BD1 bromodomain in complex with compound 662 | | Authors: | Morozova, I., Elizarova, E., Lau, K., Pojer, F., Schneuing, A., Gampp, O., Igashov, I., Correia, B. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1b | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1c | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1e | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1g | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1h | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1i | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t18 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of protein kinase CK2 catalytic subunit CK2alpha (CSNK2A1 gene product) in complex with the indenoindole-precursor compound JC0151 | | Authors: | Werner, C., Jose, J., Le Borgne, M., Niefind, K. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1j | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t16 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human BRD4-BD1 bromodomain in complex with compound 960 | | Authors: | Morozova, I., Elizarova, E., Lau, K., Pojer, F., Schneuing, A., Gampp, O., Igashov, I., Correia, B. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phenylalanine hydroxylase (PAH) with Belinostat | | Authors: | Conde-Gimenez, M., Hurtado-Guerrero, R. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tetrapodal ancestor of L-amino acid oxidases: W377I mutant bound to phenylalanine | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2025-10-21 |
|
