Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 14711 results
PDBID:9l67
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9l68
Status:HPUB -- hold until publication
Title:Crystal structure of human STING in complex with F8W
Authors:Feng, Z.W., Zeng, T., Chen, M.R., Xiao, Y.B., Xu, X.L.
Deposition date:2024-12-24
PDBID:9l6d
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9l65
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l6e
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l6a
Status:HPUB -- hold until publication
Title:Crystal structure of KRas G12D (GDP) in complex with compound 1
Authors:Amano, Y., Tateishi, Y.
Deposition date:2024-12-24
PDBID:9l6f
Status:HPUB -- hold until publication
Title:Crystal structure of KRas G12D (GDP) in complex with ASP3082
Authors:Amano, Y., Tateishi, Y.
Deposition date:2024-12-24
PDBID:9l6j
Status:HPUB -- hold until publication
Title:Structural studies on the conformation changes induced by ligand binding in an Adenine phosphoribosyltransferase (FnAPRT) from Fusobacterium nucleatum
Authors:Kim, B., Hwang, J., Do, H., Lee, J.H.
Deposition date:2024-12-24
PDBID:9l6m
Status:HPUB -- hold until publication
Title:Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound.
Authors:Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K.
Deposition date:2024-12-24
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
PDBID:9l6n
Status:HOLD -- hold until a certain date
Title:PEDV 3CLpro mutant (C144A) in complex with nsp5/6 peptite substrate
Authors:Zhang, Y., Zhang, D., Shi, Y.J., Peng, G.Q.
Deposition date:2024-12-24
Release date:2025-12-24
PDBID:9l6p
Status:HPUB -- hold until publication
Title:Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH
Authors:Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C.
Deposition date:2024-12-24
PDBID:9l6l
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9l63
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l64
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l6g
Status:HPUB -- hold until publication
Title:Cocrystallization of the flavin-dependent monooxygenase DpasF with the substrate leads to its complex with the product
Authors:Zhao, X.Y., Zhang, L.P., Zhu, Y.G., Zhang, C.S.
Deposition date:2024-12-24
PDBID:9l66
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9mnp
Status:HPUB -- hold until publication
Title:Crystal structure of mutant variant of mAb CV3-25 Fab in complex with SARS-CoV-2 spike stem helix peptide
Authors:Chandravanshi, M., Tolbert, W.D., Pazgier, M.
Deposition date:2024-12-23
PDBID:9mno
Status:HPUB -- hold until publication
Title:Structure of the TelA-associated type VII secretion system chaperone LcpA in complex with the chaperone binding site of TelA
Authors:Garrett, S.R., Kim, Y., Whitney, J.C.
Deposition date:2024-12-23
PDBID:9mnr
Status:HOLD -- hold until a certain date
Deposition date:2024-12-23
Release date:2025-12-23
PDBID:9mnq
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2024-12-23
PDBID:9mnt
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73
Authors:Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A.
Deposition date:2024-12-23
PDBID:9mns
Status:HPUB -- hold until publication
Title:Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36
Authors:Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A.
Deposition date:2024-12-23
PDBID:9mnu
Status:HPUB -- hold until publication
Title:Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48
Authors:Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A.
Deposition date:2024-12-23
PDBID:9hui
Status:HPUB -- hold until publication
Title:CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in complex with heparin oligomer (20 subunits).
Authors:Bereta, G., Bielecka, E., Biela, A., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T.
Deposition date:2024-12-23
PDBID:9huh
Status:HPUB -- hold until publication
Title:CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in 10 mM calcium
Authors:Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T.
Deposition date:2024-12-23

236963

数据于2025-06-04公开中

PDB statisticsPDBj update infoContact PDBjnumon