| PDBID: | 8v1w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v22 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of monoclonal antibody 1A05 in complex with BA.1 RBD | | Authors: | Bajic, G., Alesandro, C. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v23 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 capsid N-terminal domain in the presence of Lenacapavir | | Authors: | Briganti, L., Kvaratskhelia, M. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of polyketide synthase (PKS) thioreductase domain from Streptomyces coelicolor | | Authors: | Pereira, J.H., Dan, Q., Keasling, J., Adams, P.D. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x67 | | Status: | HPUB -- hold until publication | | Title: | solution structure of Pru p 7 | | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
| PDBID: | 8x60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x68 | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with YH21002 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8x66 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8x62 | | Status: | HPUB -- hold until publication | | Title: | crystal structure of human Mcl-1 kinase domain in complex with RM1 | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x69 | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with YH23010 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x6a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex structure of AtHPPD with Y18992 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8r64 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of tau filaments made from jR2R3-P301L peptides induced with heparin | | Authors: | Vigers, M., Han, S. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v18 | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v19 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | RNA polymerase II elongation complex with Syn conformation 8-oxoguanine with AMP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
