| PDBID: | 9iun | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Trim25 Pspry | | Authors: | Li, Y.L., Lin, T.W. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iur | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iux | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray crystal structure of human hemoglobin subunit mu C49S/C104S mutant | | Authors: | Lin, Y.W. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iuu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | JN.1 RBD with Q493E in complex with ACE2 | | Authors: | Feng, L.L. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iuy | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of mouse heavy-chain apoferritin resolved at 1.51 Angstroms | | Authors: | Wang, C.H., Wu, K.P., Chang, Y.C. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iv3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9iv2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crk | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9cry | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 Spike Proteins on intact virions: B.1 variant 3 closed RBDs | | Authors: | Ke, Z., Croll, T.I., Briggs, J.A.G. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9cr8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SapNP reconstituted human ABCB1 | | Authors: | Kurre, D., Alam, A. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cra | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Sirt6 in complex with ADP-ribose and the inhibitor 2-Pr | | Authors: | You, W., Steegborn, C. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the tungsten-dependent aldehyde:ferredoxin oxidoreductase from Clostridium autoethanogenum. | | Authors: | Lemaire, O.N., Wagner, T. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the clippase PaJOS from Pigmentiphaga aceris | | Authors: | Baumann, U., Uthoff, M., Hermanns, T., Hofmann, K. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7i | | Status: | HPUB -- hold until publication | | Title: | Structure of carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) in complex with acetyl-Coenyzme A from Clostridium autoethanogenum | | Authors: | Lemaire, O.N., Dongsheng, Y.M., Murphy, B.J., Wagner, T. | | Deposition date: | 2024-07-21 | | Sequence: | >Entity 1
MNLFQTVFTGSKQALAAAEGIVKQAVDEKGRDYKVAFPDTAYSLPVIFAATGKKITNVGELEGALDIVRSLIVEEEMLDKLLNSGLATAVAAEIIEAAKYVLSDAPYAEPCVGFISDPIIRSLGVPLVTGDIPGVAVILGECPDSETAAKIIKDYQSKGLLTCLVGKVIDQAIEGKVKMGLDLRVIPLGYDVTSVIHVVTIAIRAALIFGGIKGGQLNDILKYTAERVPAFVNAFGPLSELVVSAGAGAIALGFPVLTDQVVPEVPTLLLTQKDYDKMVKTSLEARNIKIKITEIPIPVSFAAAFEGERIRKNDMLAEFGGNKTKAWELVMCADQGEVEDHKIEVIGPDIDTIDKAPGRMPLGMLIKVSGTNMQKDFEPVLERRLHYFLNYIEGVMHVGQRNLTWVRIGKEAFEKGFRLKHFGEVIYAKMLDEFGSVVDKCEVTIITDPGKAEELEGKYAVPRYKERDARLESLVDEKVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKEGVVDENLGIWEKVNETVSKISQGAVTSVTLYSILQDPMTSCGCFECITGIMPEANGVVMVNREFGATTPLGMTFGELASMTGGGVQTPGFMGHGRQFIASKKFMKGEGGLGRIVWMPKELKDFVAEKLNKTAKELYNIDNFADMICDETIATESEEVVKFLEEKGHPALKMDPIM
>Entity 2
MEEKAKSIDQATLQLLDKAKQDGVETVWDRKADMKVQCGFGSAGVCCRNCSMGPCRVSPVPGKGVERGICGATADVIVSRNFARMVAAGTAAHSDHGRSIALSLYHTSKDGDIKVKDENKLKEVAKSFNVETEGRDIYDIAHDVAKEGLSNYGKQLGEVTLPPSLPEKRKELWRKLGVYPRAVDREIAAVMHSTHIGCNADAEAMIKMSMRCSLTDGWMGSFMGTEFSDIMFGTPHSIDTEANLGVLEKNSVNVVLHGHEPLLSEMVVEAASDPELVELAKSVGADGINLCGMCCTGNEVSMRHGIKIAGNFMQQELAVVTGAVDGLIVDVQCIMPALAKLSKSYHTKFITTSPKAHITDSIYMEFDEENPLDSAKKILKEAILNFKNRDQSKVMIPELKCKAILGYSVEEIINKLDKVVNTQIGPMQTVKPLADVLVSGVLRGAAAVVGCNNPKVVQDSAHIETIKGLIKNDVIVVVTGCAAQAAAKYGLLQKEAAEKYAGPGLATVCKLVDIPPVLHMGSCVDISRILDLVGRVANLLGVDMSDLPVAGVAPEWMSEKAVAIGTYVVTSGIDTWLGVAPPVTGGPEVVDILTNKMEDWVGAKFFIETDPHKAVEQIVNRMNEKRKKLGI
|
|
| PDBID: | 9iug | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9iui | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9iuf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9iuh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Chitinase from Vibrio parahaemolyticus at pH6.5 | | Authors: | Cheng, Q., Zhang, J. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cr9 | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cr1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of histidine racemase (HisR) of Fusobacterium nucleatum (C67S) | | Authors: | Chen, P., Lamer, T., Vederas, J.C., Lemieux, M.J. | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9cr6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of histidine racemase (HisR) of Fusobacterium nucleatum (C209S) | | Authors: | Chen, P., Lamer, T., Vederas, J.C., Lemieux, M.J. | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9cr5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of GNAT superfamily acetyltransferase PA2271 from Pseudomonas aeruginosa | | Authors: | Majorek, K.A., Cooper, D.R., Joachimiak, A., Minor, W., Midwest Center for Structural Genomics (MCSG) | | Deposition date: | 2024-07-20 |
|
