PDBID: | 9etg | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with CA-M11 | Authors: | Tassone, G., Pozzi, C., Maramai, S. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 9eth | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9esa | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9erq | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-03-25 |
|
PDBID: | 9erw | Status: | HOLD -- hold until a certain date | Title: | Mouse CNPase catalytic domain with nanobody 8C | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | Deposition date: | 2024-03-25 | Release date: | 2025-03-25 |
|
PDBID: | 9erz | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-25 |
|
PDBID: | 9es4 | Status: | HPUB -- hold until publication | Title: | ADP:BeF3-bound human mitochondrial Hsp60-Hsp10 football complex | Authors: | Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I., Shkolnisky, Y. | Deposition date: | 2024-03-25 |
|
PDBID: | 9ert | Status: | HOLD -- hold until a certain date | Title: | Mouse CNPase catalytic domain with nano body 5E | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | Deposition date: | 2024-03-25 | Release date: | 2025-03-25 |
|
PDBID: | 9ers | Status: | HPUB -- hold until publication | Title: | Hydrogenase-2 Ni-C state | Authors: | Wong, K.L., Carr, S.B., Ash, P.A., Vincent, K.A. | Deposition date: | 2024-03-25 |
|
PDBID: | 8yt8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-25 |
|
PDBID: | 8yt6 | Status: | HPUB -- hold until publication | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | Deposition date: | 2024-03-25 |
|
PDBID: | 8ytf | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-25 |
|
PDBID: | 8yt7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the MAM domain of Spodoptera frugiperda Scavenger Receptor-C | Authors: | Lan, J., Wang, C.H. | Deposition date: | 2024-03-25 |
|
PDBID: | 8yt9 | Status: | HPUB -- hold until publication | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | Deposition date: | 2024-03-25 |
|
PDBID: | 8yta | Status: | HPUB -- hold until publication | Title: | The crystal structure of PDE8A with 1604R | Authors: | Huang, Y.-Y., Luo, H.-B. | Deposition date: | 2024-03-25 |
|
PDBID: | 8yth | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-25 |
|
PDBID: | 8ytc | Status: | HPUB -- hold until publication | Title: | PML-RBCC dimer | Authors: | Tan, Y.T., Li, J.L. | Deposition date: | 2024-03-25 |
|
PDBID: | 8ytb | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of enterovirus A71 empty particle | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | Deposition date: | 2024-03-25 |
|
PDBID: | 8ytg | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-25 |
|
PDBID: | 9b6l | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-25 |
|
PDBID: | 9b6m | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-25 | Release date: | 2025-03-25 |
|
PDBID: | 9b6n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Fab1-1 in complex with the capsid of Adeno-associated virus type 9 | Authors: | Mietzsch, M., McKenna, R. | Deposition date: | 2024-03-25 |
|
PDBID: | 9b6d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-25 |
|
PDBID: | 9b6e | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-25 |
|
PDBID: | 9b6f | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-03-25 |
|