| PDBID: | 8vct | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody (GPC-C epitope) | | Authors: | Brouwer, P.J.M., Perrett, H.R., Ward, A.B. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vd3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with galactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8xev | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8xex | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with AMP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8xf5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with ADP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8xet | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfe | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associated sirtuin 2 (DSR2) H171A protein in complex with DSR anti-defence 1(DSAD1) | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xew | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein in complex with SPR phage tail tube protein | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the ATP-bound Mtb DppABCD with the D445A mutation of DppA | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xeu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xf7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xez | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 5 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xf6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV, ITGB3 and Cilengitide TFA complex, conformation 2 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xf4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xf9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MiCGT(E152Q/V190D/S122P) in complex with UDP | | Authors: | Zhang, Z.M., Zhou, Z.Q. | | Deposition date: | 2023-12-13 |
|
