| PDBID: | 8ukn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8wrf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MexL | | Authors: | Wei, Y., Wu, Z.K. | | Deposition date: | 2023-10-14 | | Release date: | 2025-04-14 | | Sequence: | >Entity 1
GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
| PDBID: | 8ukp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8qu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 | | Release date: | 2025-04-16 |
|
| PDBID: | 8qtv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 | | Release date: | 2025-04-13 |
|
| PDBID: | 8uki | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 04_A06 Fab | | Authors: | DeLaitsch, A.T., Gristick, H.B., Bjorkman, P.J. | | Deposition date: | 2023-10-13 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ukj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wrc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Time-Resolved Ambient Temperature Kineto-Crystallographic Structure of Initiation Factor in Complex with Ribosome | | Authors: | DeMirci, H., Yapici, I. | | Deposition date: | 2023-10-13 | | Release date: | 2025-01-29 |
|
| PDBID: | 8qtb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 8qte | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF THE COMPLEX BETWEEN ADENYLATE KINASE MUTANT R78A FROM ESCHERICHIA COLI AND THE INHIBITOR AP5A | | Authors: | Rodriguez, J.A., Wolf-Watz, M., Phoeurk, C. | | Deposition date: | 2023-10-12 | | Release date: | 2025-04-12 | | Sequence: | >Entity 1
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCANGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
|
|
| PDBID: | 8ukb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-12 |
|
| PDBID: | 8wr3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8qss | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF THE COMPLEX BETWEEN ADENYLATE KINASE MUTANT N138A FROM ESCHERICHIA COLI AND THE INHIBITOR AP5A | | Authors: | Rodriguez, J.A., Magnus, W.W., Phoeurk, C. | | Deposition date: | 2023-10-11 | | Release date: | 2025-04-11 |
|
| PDBID: | 8qsp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 | | Release date: | 2025-01-11 |
|
| PDBID: | 8uji | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8uj9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 | | Release date: | 2025-04-10 |
|
| PDBID: | 8uj4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-11 | | Release date: | 2025-01-10 |
|
| PDBID: | 8uj5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-11 | | Release date: | 2025-01-10 |
|
| PDBID: | 8uj8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-11 | | Release date: | 2025-01-10 |
|
| PDBID: | 8ujr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8ujb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8ujk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 | | Release date: | 2025-04-10 |
|
| PDBID: | 8ujn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8ujo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8ujj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 | | Release date: | 2025-04-10 |
|
