| PDBID: | 8thf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-15 |
|
| PDBID: | 8pu1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the toxin/antitoxin complex FaRel/ATfaRel2 with APCPP | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu2 | | Status: | HPUB -- hold until publication | | Title: | Structure of the antitoxin ATfaRel2 | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu3 | | Status: | HPUB -- hold until publication | | Title: | Complex of the toxin/antitoxin FaRel2/ATfaRel2 | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu4 | | Status: | HPUB -- hold until publication | | Title: | FaRel2 bound to the ATP analogue, APCPP | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8k3l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8k3o | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8pu5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Acyl-CoA dehydrogenase FadE1(PA0506) E441A from Pseudomonas aeruginosa complexed with C16CoA | | Authors: | Wang, M., Brear, P., Welch, M. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8k3j | | Status: | HPUB -- hold until publication | | Title: | Structure of human CNTN2 immunoglobulin domains 1-6 homo-dimer | | Authors: | Zhang, Z.Z. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8puk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8pul | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8puj | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Martinez-Felices, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8k48 | | Status: | HPUB -- hold until publication | | Title: | LTD of arabidopsis thaliana | | Authors: | Wang, C., Xu, X.M. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8k3z | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CXCR4 in complex with CXCL12 | | Authors: | Liu, Y.Z., Liu, A.J., Liao, Q.W. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8pv0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8pup | | Status: | HPUB -- hold until publication | | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with purpurogallin-like compound | | Authors: | Kotacka, T., Radilova, K. | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8puz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8put | | Status: | HPUB -- hold until publication | | Title: | IF5A in complex with Deoxyhypusine synthase | | Authors: | Ennifar, E., D''agostino, M. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8puu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8puv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8tho | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | | Deposition date: | 2023-07-17 | | Sequence: | >Entity 1
SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|
| PDBID: | 8thq | | Status: | HPUB -- hold until publication | | Title: | Nonamer RNA bound to hAgo2-PAZ | | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8pvy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound FX-171-C | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8pvr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8pvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
