| PDBID: | 9ve3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9ve5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9vea | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9veh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9vem | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SIRT2 structure in complex with H3K18myr peptide and native NAD: pre-catalysis state 1 | | Authors: | Zhang, N., Hao, Q. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9ve6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9ve7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9ve8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9veb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1a | | Status: | HPUB -- hold until publication | | Title: | B. pseudomallei rubrerythrin room temperature structure from LEAP-X device | | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p14 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p15 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p11 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p0y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N | | Authors: | Ribeiro, F.S., Lima, L.M.T.R. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p0z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N (Duplicate) | | Authors: | Ribeiro, F.S., Lima, L.M.T.R. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p10 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N (Triplicate) | | Authors: | Lima, L.M.T.R., de Sa Ribeiro, F. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p19 | | Status: | HPUB -- hold until publication | | Title: | B. pseudomallei rubrerythrin room temperature structure | | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p16 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Thermolysin Room-Temperature In-Situ | | Authors: | Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1b | | Status: | HPUB -- hold until publication | | Title: | P. putida mandelate racemase co-crystallized with tavaborole | | Authors: | Jabin, A., Hayden, J.A., Bearne, S.L., St.Maurice, M. | | Deposition date: | 2025-06-09 | | Sequence: | >Entity 1
MASWSHPQFEKGALEVLFQGPGYHMSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
|
|
| PDBID: | 9p17 | | Status: | HPUB -- hold until publication | | Title: | Thermolysin Room-Temperature In-Situ | | Authors: | Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1f | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sindhis virus post-fusion E1 structure | | Authors: | Shi, K., Zhang, W. | | Deposition date: | 2025-06-09 |
|
