| PDBID: | 8kb4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8q2z | | Status: | HPUB -- hold until publication | | Title: | HsNMT1 in complex with both MyrCoA and GNLLSKFR peptide | | Authors: | Dian, C., Giglione, C., Meinnel, T. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8ton | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-03 | | Release date: | 2024-08-03 |
|
| PDBID: | 8to8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8tog | | Status: | HPUB -- hold until publication | | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | | Deposition date: | 2023-08-03 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8top | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with antibody GPZ6-b.01 targeting the fusion peptide | | Authors: | Zhou, T., Morano, N.C., Roark, R.S., Kwong, P.D. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8toh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8to9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8to7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8toe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8tom | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8kby | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8kbx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8kb8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8kb9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8kbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8kbc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbe | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbl | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8kbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
