| PDBID: | 8qu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 | | Release date: | 2025-04-16 |
|
| PDBID: | 8qu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the FB-bound yeast Ceramide Synthase | | Authors: | Schaefer, J., Clausmeyer, L., Koerner, C., Moeller, A., Froehlich, F. | | Deposition date: | 2023-10-13 | | Release date: | 2024-10-13 |
|
| PDBID: | 8uki | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 04_A06 Fab | | Authors: | DeLaitsch, A.T., Gristick, H.B., Bjorkman, P.J. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukg | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the lasso peptide wygwalassin-A1 | | Authors: | Saad, H., Zhu, L., Harris, L.A., Shelton, K.E., Mitchell, D.A. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8ukl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wrc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Time-Resolved Ambient Temperature Kineto-Crystallographic Structure of Initiation Factor in Complex with Ribosome | | Authors: | DeMirci, H., Yapici, I. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wrd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wre | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8uko | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8ukn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8ukp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8wrg | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the TAD domain (450-504) of human transcriptional coactivator YAP1 | | Authors: | Zhang, H., Li, Y. | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8wrf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MexL | | Authors: | Wei, Y., Wu, Z.K. | | Deposition date: | 2023-10-14 | | Sequence: | >Entity 1
GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
| PDBID: | 8wri | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of FrCas9 in complex with sgRNA and 26-nt TS and 4-nt NTS substrates | | Authors: | Chen, S.D., Yang, M., Liu, S.Q. | | Deposition date: | 2023-10-15 |
|
| PDBID: | 8wrn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-15 | | Release date: | 2024-10-15 |
|
| PDBID: | 8qum | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8quo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8quf | | Status: | HPUB -- hold until publication | | Title: | carbonic anhydrase XII mimic in complex with 2-(3-((N-(4-sulfamoylbenzyl)pyridine-3-sulfonamido)methyl)phenoxy)acetic acid | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 05_B08 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 |
|
