| PDBID: | 8u3p | | Status: | HPUB -- hold until publication | | Title: | 1.79 Angstrom resolution crystal structure of KatG from Mycobacterium tuberculosis with an MYW cofactor after heat incubation for 60 minutes | | Authors: | Liu, A., Li, J., Ran, D. | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8u3u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the SARS-CoV-2 Omicron nsp5 main protease (Mpro) E166V mutant in complex with inhibitor Nirmatrelvir (PF-07321332) | | Authors: | Neilsen, G., Kirby, K.A., Sarafianos, S.G. | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8u3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8wb1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8wb5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8wb3 | | Status: | HPUB -- hold until publication | | Title: | Human H Chain Ferritin mutant-K86Q with 2 Fe(III)/subunit loading | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8wbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-09 |
|
| PDBID: | 8wbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-09 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8qhu | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 snoRNA overexpression | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8u4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8u4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8wbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8wby | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8wbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8qhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
