| PDBID: | 8teh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-06 |
|
| PDBID: | 8tei | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-06 |
|
| PDBID: | 8tej | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-06 |
|
| PDBID: | 8tel | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-06 |
|
| PDBID: | 8tem | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-06 |
|
| PDBID: | 8ten | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-06 |
|
| PDBID: | 8k04 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of a 2,3-hydroxycinnamic acid 1,2-dioxygenase MhpB in apo form | | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Xing, Q. | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8k0a | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of 3-phenylpropionate/cinnamic acid dioxygenase HcaE-HcaF complex | | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Xing, Q. | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8k03 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8k08 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8k09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8tf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8tf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8tev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8tez | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8tf1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8tf6 | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | | Deposition date: | 2023-07-07 | | Sequence: | >Entity 1
(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8k0e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-08 | | Release date: | 2025-01-08 |
|
| PDBID: | 8k0f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-08 | | Release date: | 2025-01-08 |
|
| PDBID: | 8k0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8k0l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-09 |
|
| PDBID: | 8k0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-09 |
|
| PDBID: | 8k0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-09 |
|
| PDBID: | 8k0i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-09 |
|
| PDBID: | 8k0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-09 |
|
