PDBID: | 8qie | Status: | HPUB -- hold until publication | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 mutant snoRNA overexpression, class 4 | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u59 | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-12 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8u54 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u56 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u58 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5c | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5q | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5s | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5n | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5l | Status: | HPUB -- hold until publication | Title: | MAU868, a novel human-derived monoclonal neutralizing antibody targeting BK virus VP1 | Authors: | Knapp, M.S., Ornelas, E. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of human IDO1 bound to Compound 23 | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5o | Status: | HPUB -- hold until publication | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u57 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8wcf | Status: | HPUB -- hold until publication | Title: | Crystal structure of EcThsB | Authors: | Chen, Q., Yu, Y. | Deposition date: | 2023-09-12 |
|
PDBID: | 8wck | Status: | AUTH -- processed, waiting for author review and approval | Title: | FCP tetramer in Chaetoceros gracilis | Authors: | Feng, Y., Li, Z., Zhou, C., Shen, J.-R., Liu, C., Wang, W. | Deposition date: | 2023-09-12 |
|
PDBID: | 8wcl | Status: | AUTH -- processed, waiting for author review and approval | Title: | FCP pentamer in Chaetoceros gracilis | Authors: | Feng, Y., Li, Z., Zhou, C., Liu, C., Shen, J.-R., Wang, W. | Deposition date: | 2023-09-12 |
|
PDBID: | 8wcj | Status: | HPUB -- hold until publication | Title: | Crystal structure of GB3 penta mutation L5V/K10H/T16S/K19E/Y33I | Authors: | Qin, M.M., Chen, X.X., Zhang, X.Y., Song, X.F., Yao, L.S. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qjb | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8qjk | Status: | HPUB -- hold until publication | Title: | Structure of the cytoplasmic domain of csx23 from Vibrio cholera in complex with cyclic tetra-adenylate (cA4) | Authors: | McMahon, S.A., McQuarrie, S., Gloster, T.M., Gruschow, S., White, M.F. | Deposition date: | 2023-09-13 | Sequence: | >Entity 1 GANAMDEITVVLKSPNGKNIKCPPMPRKDFSRAEVLGYIGMCSGAQRFEIASLKTPKFGENLLKIIKSKGSQSFIVDCTDEEIDQFSAETKSGSNA
>Entity 2 AAAA
|
|
PDBID: | 8qjl | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8qjm | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8qjn | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8qjo | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8qjd | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8qjc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-13 |
|