| PDBID: | 8tse | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8tsk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8tsm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-11 | | Release date: | 2024-08-11 |
|
| PDBID: | 7gau | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition of ground-state model of MAP1LC3B | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8ken | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8kel | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel Mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8keu | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 8ker | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 XBB Variant Spike protein complexed with broadly neutralizing antibody PW5-535 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8kep | | Status: | HPUB -- hold until publication | | Title: | The local refined map of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8keo | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8keq | | Status: | HPUB -- hold until publication | | Title: | State 1 of SARS-CoV-2 XBB Variant Spike protein trimer complexed with antibody PW5-5 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8kes | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8kev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8kew | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8ket | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human complex A | | Authors: | Qian, H.W., He, J.J. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8tt9 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
| PDBID: | 8ttc | | Status: | HOLD -- hold until a certain date | | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302) | | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 8ttd | | Status: | HOLD -- hold until a certain date | | Title: | Structure of VPS29 complexed with Fam21A repeat 21 (1328-1341) | | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 8tt8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8tta | | Status: | HOLD -- hold until a certain date | | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341) | | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 8kex | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8kf0 | | Status: | HPUB -- hold until publication | | Title: | Structure of chimera LGR5 complex with LGR4 N-terminal and MB52 | | Authors: | Qiao, H.R., Wang, L. | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2024-08-14 |
|
| PDBID: | 8q6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
