| PDBID: | 8k59 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-21 |
|
| PDBID: | 8tjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-21 |
|
| PDBID: | 8px3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-22 |
|
| PDBID: | 8px6 | | Status: | HPUB -- hold until publication | | Title: | Hepatitis B core protein with bound SLLGRM-dimer | | Authors: | Makbul, C., Khayenko, V., Maric, M.H., Bottcher, B. | | Deposition date: | 2023-07-22 |
|
| PDBID: | 8pxo | | Status: | PROC -- to be processed | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8pxd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C-terminal domain of Hh1412 | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 8pxf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the full length Hh1412 Dsb homodimer. | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 8pxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8pxb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8pxe | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal dimerisation domain of Hh1141 | | Authors: | Wilk, P., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MASFEDTLKATIKSNTKQDIKILKIQNLQSSPDVKLVLIAVGNMQVPIFASKDGKLVMGVSNVFFAHKSEDMGAVGSLIKQTQSESKPDKAILDTLFKKIPQDEYIILRSPNKNAKKITYIVSDPNCPSCQKELNNIQERLKDSDVYMLLVGFVGEDSPIKSSMLRDRLLDVKDDKEKLKILREVYTPKSKVPTSYINIDIKDTMKINQKVIDAGIKSVPFVYERNKLEHHHHHHH
|
|
| PDBID: | 8tjn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked State 1 | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8tjo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked Intra-State 1 | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8tjp | | Status: | HPUB -- hold until publication | | Title: | KS-AT core of 6-deoxyerythronolide B synthase (DEBS) Module 3 crosslinked with its elongation ACP partner | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8py2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound JMS-175-2 | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8pxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8py0 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Oscillibacter ruminantium chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8pxp | | Status: | HPUB -- hold until publication | | Title: | Compound II structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Thompson, A., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8pxq | | Status: | HPUB -- hold until publication | | Title: | SFX Ferric structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Pfalzgraf, H. | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8pxr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SFX Ferryl structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Pfalzgraf, H. | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8pxy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8py1 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Asticcacaulis benevestitus chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8k5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8k5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8k62 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8k60 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Streptomyces coelicolor transcription initiation complex with the global transcription factor AfsR | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-07-24 |
|
