PDBID: | 8teh | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-06 |
|
PDBID: | 8tei | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-06 |
|
PDBID: | 8tej | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-06 |
|
PDBID: | 8tel | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-06 |
|
PDBID: | 8tem | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-06 |
|
PDBID: | 8ten | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-06 |
|
PDBID: | 8k04 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of a 2,3-hydroxycinnamic acid 1,2-dioxygenase MhpB in apo form | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Xing, Q. | Deposition date: | 2023-07-07 |
|
PDBID: | 8k0a | Status: | HPUB -- hold until publication | Title: | CryoEM structure of 3-phenylpropionate/cinnamic acid dioxygenase HcaE-HcaF complex | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Xing, Q. | Deposition date: | 2023-07-07 |
|
PDBID: | 8k03 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-07 |
|
PDBID: | 8k08 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-07 |
|
PDBID: | 8k09 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8tf0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 |
|
PDBID: | 8tf5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8tev | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-07 |
|
PDBID: | 8tez | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 |
|
PDBID: | 8tf1 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 |
|
PDBID: | 8tf6 | Status: | HPUB -- hold until publication | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | Deposition date: | 2023-07-07 | Sequence: | >Entity 1 (MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8k0e | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-08 | Release date: | 2025-01-08 |
|
PDBID: | 8k0f | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-08 | Release date: | 2025-01-08 |
|
PDBID: | 8k0g | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-09 | Release date: | 2025-01-09 |
|
PDBID: | 8k0l | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-09 |
|
PDBID: | 8k0k | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-09 |
|
PDBID: | 8k0m | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-09 |
|
PDBID: | 8k0i | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-09 |
|
PDBID: | 8k0h | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-09 |
|