| PDBID: | 8js7 | | Status: | HPUB -- hold until publication | | Title: | Dimeric PAS domains of oxygen sensor FixL in complex with imidazole-bound heme | | Authors: | Kamaya, M., Koteishi, H., Sawai, H., Sugimoto, H., Shiro, Y. | | Deposition date: | 2023-06-19 |
|
| PDBID: | 8js5 | | Status: | HPUB -- hold until publication | | Title: | Dimeric PAS domains of oxygen sensor FixL with ferric unliganded heme | | Authors: | Kamaya, M., Koteishi, H., Sawai, H., Sugimoto, H., Shiro, Y. | | Deposition date: | 2023-06-19 |
|
| PDBID: | 8js6 | | Status: | HPUB -- hold until publication | | Title: | Dimeric PAS domains of oxygen sensor FixL in complex with cyanide-bound ferric heme | | Authors: | Kamaya, M., Koteishi, H., Sawai, H., Sugimoto, H., Shiro, Y. | | Deposition date: | 2023-06-19 |
|
| PDBID: | 8jsd | | Status: | HPUB -- hold until publication | | Title: | Alginate lyase mutant-D180G | | Authors: | Zhang, X., Pan, L.X., Yang, D.F. | | Deposition date: | 2023-06-19 |
|
| PDBID: | 8jsa | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2023-06-19 |
|
| PDBID: | 8phc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8jse | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8jsf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a cytidylate cyclase from multidrug-resistant bacterium Elizabethkingia anopheles | | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a DNA-protein complex | | Authors: | Li, Z. | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of a uridylate cyclase from Anabaena sp. | | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an N-terminal cyclic nucleotide-binding domain of a PycTIR from Novosphingobium pentaromativorans | | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an N-terminal cyclic nucleotide-binding domain of a PycTIR from Pseudovibrio sp. in complex with cUMP | | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jst | | Status: | HPUB -- hold until publication | | Title: | GH11 family xylanase rMxylcd from the compost-soil metagenome | | Authors: | Wu, S.N., Zhang, N.Y., Wan, Q. | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsq | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jss | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jt0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8jsv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8phz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 | | Release date: | 2024-09-20 |
|
| PDBID: | 8pi0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8phn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 |
|
| PDBID: | 8phx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 |
|
| PDBID: | 8jsr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-20 | | Release date: | 2024-09-25 |
|
