| PDBID: | 7hju | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000039132637 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hjv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000000173360 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hjw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000002571408 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hjx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000000066090 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hjy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000000389796 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hjz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000016697555 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hk0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000004774482 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hk1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000000107891 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hk2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000000034687 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hk3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000000053963 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 7hk4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of ABLE in complex with ZINC000038866729 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jv8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h00 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h02 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CREBBP histone acetyltransferase domain in complex with a bisubstrate inhibitor, Lys-CoA | | Authors: | Mechaly, A.E., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h0a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h01 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | nsp14 of SARS-CoV-2 in complex with a camelid nanobody | | Authors: | Gauffre, P., Ferron, F., Canard, B. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h03 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h05 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9jtt | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Beta-glucosidase from the Indigo-producing Plant Polygonum tinctorium | | Authors: | Yoneda, K., Himeno, M., Sakuraba, H., Ohshima, T. | | Deposition date: | 2024-10-07 | | Sequence: | >Entity 1
LKRTSFPKKFLFGAGSASYQYEGAAHIDGRGLSVWDVFTKEHPEKIADQSNGDVAQDFYHRYKEDIKSMKEMGLESFRFSISWSRILPNGKISGGINKLGIKFYNNLIDELLANGIKPLVTIYHWDLPQALQDEYGGFLSPKIVDDFLEYANLVFKEFGDRVKHWATLNEPNIMTQQGYVFGAHAPGRCSHFEWNCPAGNSGTEPYIVGHHLLLCHAAAFQLYKQKYKDDQKGIIGITTATQMAIPLNDNVANLLAASRAIDFNIGWFLHPVVYGEYPQTMRERLGSRLPKFTEKESEMLKQSFDFIGLNYYSTDYAAASSFSVDPVNVSYTTDSRATLSAIKDGVPIGDPTFMSWLHIYPEGILTLLRYVKERYNNPFVMITENGMADENKGSLAEDPMALKDNVRIRYHREHLYYVLEAIKEGVNVGGYYAWTWMDDFEWGSGYTPRFGLNFVDFDNDLKRTPKDSYFWFKDFLAN
|
|
| PDBID: | 9ju3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-fold Block-refine of Full particle of phiYY, a prokaryotic dsRNA virus | | Authors: | Meng, K.W., Cui, C.X., HuYan, Y.N., Zhang, X.Z., Meng, G. | | Deposition date: | 2024-10-07 |
|
