| PDBID: | 8z78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea with glycerol | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 EG.5.1 Spike in complex with CYFN1006-2(S-CYFN1006-2 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6y | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH mutant-V164K&V221A&H333K | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 XBB.1.16 Spike in complex with CYFN1006-1(S-CYFN1006-1 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6w | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 S trimer with 3 down-RBDs complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bh5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgz | | Status: | HPUB -- hold until publication | | Title: | Ancestral uncoupled aspartate transporter, apo conditions, high-affinity state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bh0 | | Status: | HPUB -- hold until publication | | Title: | Ancestral uncoupled aspartate transporter in complex with L-aspartate | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bh2 | | Status: | HPUB -- hold until publication | | Title: | Apo GltPh, outward-facing state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 | | Sequence: | >Entity 1
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLVPR
|
|
| PDBID: | 9bh1 | | Status: | HPUB -- hold until publication | | Title: | Apo GltPh, intermediate outward-facing state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bhc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bh3 | | Status: | HPUB -- hold until publication | | Title: | Structure of apo Aggregatibacter actinomycetemcomitans SiaP protein | | Authors: | King-Hudson, T.-R.J., Davies, J.S., Dobson, R.C.J. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgl | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bh4 | | Status: | HPUB -- hold until publication | | Title: | PRMT1 hexamer, Protein Arginine Methyl transferase | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bhe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bhd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PRMT1-Octamer | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-19 |
|
