| PDBID: | 9lpi | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 glucose complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lpc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3s | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A10B10 glyceraldehyde-3-phospahte dehydrogenase from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F., Del Giudice, A. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the AGR2 dimer in complex with the monomeric IRE1beta luminal domain | | Authors: | Yan, Y., Hardwick, S., Tung, J., Ron, D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE triple mutant (Ile12Phe, Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n17 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n16 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n19 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n12 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n15 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) in complex with 6-nitrobenzotriazole | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 | | Release date: | 2026-01-24 |
|
| PDBID: | 9n0o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-24 | | Release date: | 2026-01-24 |
|
| PDBID: | 9n0p | | Status: | HPUB -- hold until publication | | Title: | Open tetramer | | Authors: | Gupta, J., Izard, T. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0w | | Status: | HPUB -- hold until publication | | Title: | HTLV-1 Gag capsid from immature particles | | Authors: | Arndt, W.G., Ramezani, A., Chen, B., Perilla, J.R., Zhang, W., Mansky, L.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0z | | Status: | HPUB -- hold until publication | | Title: | PP2A-B55 Holoenzyme with B55i | | Authors: | Shi, S. | | Deposition date: | 2025-01-24 |
|
