| PDBID: | 9nz9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfNth1:Tg-DNA duplex complex in a pre-intermediate state | | Authors: | Syed, A., Arvai, A.S., Tsai, C.L., Tainer, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of vaccine elicited antibody 22F5 bound to the post-fusion conformation of the LayV-F glycoprotein. | | Authors: | Kumar, U., May, A., Acharya, P. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of antibody 22F5 in complex with pre-fusion stabilized LayV-F | | Authors: | May, A.J., Kumar, U., Acharya, P. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nze | | Status: | HPUB -- hold until publication | | Title: | De novo designed exatecan-binding protein, EPIC | | Authors: | Polizzi, N.F. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzg | | Status: | HPUB -- hold until publication | | Title: | De novo designed exatecan-binding protein, EPIC Q51N | | Authors: | Polizzi, N.F. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfNth1-K122A mutant bound to Tg-DNA duplex complex in an intermediate state | | Authors: | Hitomi, K., Arvai, A.S., Syed, A., Parikh, S., Tainer, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nza | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz1 | | Status: | HPUB -- hold until publication | | Title: | Adeno-associated virus serotype 11 basic regions in complex with importin alpha 2 | | Authors: | Hoad, M., Forwood, J.K. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the relaxase domain of RelpLS20, prototype of MobL family of relaxases | | Authors: | Crespo, I., Boer, D.R. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqe | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the SN230G6 Fab - HLA-A*02:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Schneider, S., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qpy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 as isolated form at 1.07-A resolution | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq5 | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 in a partially oxidized state | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qqh | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 oxidized then chemically reduced | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qqi | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 untreated control of a redox cycling experiment | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qq7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human carbonic anhydrase VII in complex with a benzenesufonamide derivative containing the duloxetine moiety | | Authors: | D''Ambrosio, K., Di Fiore, A., De Simone, G. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qpz | | Status: | HPUB -- hold until publication | | Title: | KRAS-WT(1-169) - GDP IN COMPLEX WITH compound (R)-1 | | Authors: | Ostermann, N. | | Deposition date: | 2025-03-31 |
|
