PDBID: | 9bvd | Status: | HPUB -- hold until publication | Title: | Crystal structure of SRY HMG box bound to DNA | Authors: | Georgiadis, M.M. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvr | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-20 |
|
PDBID: | 9bv5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-20 |
|
PDBID: | 9bv6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bv7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bv9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bva | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvb | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvc | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvp | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvo | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvh | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-20 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bvw | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS-CoV-2 main protease bound to inhibitor SR-B-103 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 9bvx | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS-CoV-2 main protease bound to inhibitor YR-C-155 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 9bvz | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS-CoV-2 main protease bound to inhibitor AR-A-135 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 8zlf | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of DH domain of FYVE Domain containing protein(FP10) from Entamoeba histolytica | Authors: | Gautam, A.K., Umarao, P., Gourinath, S. | Deposition date: | 2024-05-19 |
|
PDBID: | 8zle | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-19 |
|
PDBID: | 9bv4 | Status: | HPUB -- hold until publication | Title: | NMR Solution Structure of Excelsatoxin A in DPC micelles | Authors: | Saipriyaa, P.V., Chin, Y.K., Mehdi, M. | Deposition date: | 2024-05-19 |
|
PDBID: | 9bv1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-19 |
|