| PDBID: | 9iww | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''872 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain(R69H) in complexed with GSK''872 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with LK01003 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''843 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GW''39B | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with PP2 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with TAK-632 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with compound 18 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix9 | | Status: | HPUB -- hold until publication | | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix8 | | Status: | HPUB -- hold until publication | | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
| PDBID: | 9iwv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Lsd18 after incubation with the substrate | | Authors: | Wang, Q., Kim, C.Y., Chen, X. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix5 | | Status: | HPUB -- hold until publication | | Title: | An agonist(compound 15n) of Thyroid Hormone Receptor B | | Authors: | Yao, B., Li, Y. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwu | | Status: | HPUB -- hold until publication | | Title: | CTB10_M40BpA_M86I-R-1d | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas12X2 with crRNA | | Authors: | Xi, Z. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of homolog of dihydroxyacid dehydratase(AstD) from Aspergillus terreus | | Authors: | Huang, W.X., Zhang, P.X., Zhou, J.H. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ixa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of chikungunya virus glycoprotein E1-E2 with C34 Fab. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9g9l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g9u | | Status: | HOLD -- hold until a certain date | | Title: | The structure of XynX, a NIF3 family protein from Geobacillus proteiniphilus T-6 | | Authors: | Hadad, N., Pomyalov, S., Lavid, N., Shoham, Y., Shoham, G. | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9g9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g9w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g9a | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Enterococcus italicus Csm-crRNA (3.2 complex) | | Authors: | Jungfer, K., Jinek, M. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g9b | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Enterococcus italicus Csm-crRNA (4.3) complex | | Authors: | Jungfer, K., Jinek, M. | | Deposition date: | 2024-07-25 |
|
