| PDBID: | 9d2y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d37 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d38 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d39 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d32 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the HKU5 RBD bound to the P. abramus ACE2 receptor | | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D. | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d33 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3f | | Status: | HPUB -- hold until publication | | Title: | Water and chloride as allosteric inhibitors in WNK kinase osmosensing | | Authors: | Akella, R., Goldsmith, E.J. | | Deposition date: | 2024-08-09 | | Sequence: | >Entity 1
QEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQERKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEET
|
|
| PDBID: | 9j48 | | Status: | HPUB -- hold until publication | | Title: | GFP bound to 24-mer DARPin-apoferritin model 6c | | Authors: | Lu, X., Yan, M., Zhang, H.M., Hao, Q. | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9j46 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-09 | | Release date: | 2025-08-09 |
|
| PDBID: | 9j4m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-09 | | Release date: | 2025-08-09 |
|
| PDBID: | 9j4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9j4n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9j47 | | Status: | HPUB -- hold until publication | | Title: | ScdA cysteine-free mutant from Staphylococcus aureus | | Authors: | Liao, W.Y., Hu, N.J., Chiang, Y.W. | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9j41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
