Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 25997 results
PDBID:9bzd
Status:HPUB -- hold until publication
Title:Class 23 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzg
Status:HPUB -- hold until publication
Title:Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders
Authors:Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A.
Deposition date:2024-05-24
PDBID:9bze
Status:HPUB -- hold until publication
Title:Class 26 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzh
Status:HPUB -- hold until publication
Title:Class 29 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzl
Status:HPUB -- hold until publication
Title:Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders
Authors:Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A.
Deposition date:2024-05-24
Sequence:

>Entity 1


GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRT(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNSQNKESASKQS
PDBID:9bzk
Status:HPUB -- hold until publication
Title:Class 43 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzm
Status:HPUB -- hold until publication
Title:Class 45 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9bzo
Status:HPUB -- hold until publication
Title:Class 50 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-24
PDBID:9c09
Status:HPUB -- hold until publication
Title:Structure of K2P13.1 (THIK1) S136P in lipid nanodisc
Authors:Roy-Chowdhury, S., Adberemane-Ali, F., Minor, D.L.
Deposition date:2024-05-24
PDBID:9c0a
Status:AUTH -- processed, waiting for author review and approval
Title:Effect of glutathione on the stability, dynamics and catalysis of two different classes of glutathione transferases from Taenia solium
Authors:Miranda-Blancas, R., Sanchez-Juarez, C., Sanchez-Perez, L., Zubillaga, R., Flores-Lopez, R., Landa, A., Miranda-Blancas, R., Garcia-Gutierrez, P., Rudino-Pinera, E.
Deposition date:2024-05-24
PDBID:9c08
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Sialyl transferase from Pasturella Multocida
Authors:Subramanian, R., Dhanabalan, K.
Deposition date:2024-05-24
PDBID:9fgm
Status:WAIT -- processing started, waiting for author input to continue processing
Deposition date:2024-05-24
PDBID:9fgn
Status:AUTH -- processed, waiting for author review and approval
Title:Coxsackievirus A9 bound with compound 18 (CL304)
Authors:Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C.
Deposition date:2024-05-24
PDBID:9fgk
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
PDBID:9fgj
Status:HPUB -- hold until publication
Deposition date:2024-05-24
PDBID:9fgl
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
PDBID:9fgq
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Structure of human APC3loop 375-381 bound to the NCP
Authors:Young, R.V.C., Muhammad, R., Alfieri, C.
Deposition date:2024-05-24
PDBID:9fgo
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal structure of Enterovirus 71 2A protease mutant C110A containing VP1-2A junction in the active site
Authors:Ni, X., Koekemoer, L., Williams, E.P., Wang, S., Wright, N.D., Godoy, A.S., Aschenbrenner, J.C., Balcomb, B.H., Lithgo, R.M., Marples, P.G., Fairhead, M., Thompson, W., Kirkegaard, K., Fearon, D., Walsh, M.A., von Delft, F.
Deposition date:2024-05-24
PDBID:9fgi
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
Release date:2025-05-24
PDBID:8zmx
Status:HPUB -- hold until publication
Deposition date:2024-05-24
PDBID:8zmy
Status:AUTH -- processed, waiting for author review and approval
Title:F0502B-bound WT polymorph 5a alpha-synuclein fibril
Authors:Liu, K.E., Tao, Y.Q., Li, D., Liu, C.
Deposition date:2024-05-24
PDBID:8zmz
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-24
PDBID:8zmv
Status:PROC -- to be processed
Title:Structure of a triple-helix region of human Collagen type XVII from Trautec
Authors:Chu, Y., Zhai, Y., Fan, X., Fu, S., Li, J., Wu, X., Cai, H., Wang, X., Li, D., Feng, P., Cao, K., Qian, S.
Deposition date:2024-05-24
PDBID:8zmw
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a triple-helix region of human Collagen type VII from Trautec
Authors:Chu, Y., Zhai, Y., Fan, X., Fu, S., Li, J., Wu, X., Cai, H., Wang, X., Li, D., Feng, P., Cao, K., Qian, S.
Deposition date:2024-05-24
PDBID:9byb
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-05-23

221051

건을2024-06-12부터공개중

PDB statisticsPDBj update infoContact PDBjnumon