| PDBID: | 7gy3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gxq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gwk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 7gwl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xs8 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Benzo[a]pyrene | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xss | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsm | | Status: | HPUB -- hold until publication | | Title: | transporter | | Authors: | Jiang, D.H., Wang, K. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xsk | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of PPAT | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8rmu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk6 | | Status: | HPUB -- hold until publication | | Title: | Amide-linked, extended 14alpha-demethylase (CYP51) with antifungal azole inhibitor | | Authors: | Tyndall, J.D.A., Monk, B.C., Simons, C. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjz | | Status: | HPUB -- hold until publication | | Title: | HLA-A*03:01 with WT KRAS-10mer | | Authors: | Sim, M.J.W., Sun, P.D. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 | | Sequence: | >Entity 1
MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2
MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
| PDBID: | 8xs1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrq | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | | Authors: | Liu, C.C., Ju, B., Zhang, Z. | | Deposition date: | 2024-01-08 |
|
