| PDBID: | 8xr0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21618 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH23025 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xqc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rm8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 | | Release date: | 2025-01-05 |
|
| PDBID: | 8rm4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rme | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rm9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 | | Release date: | 2025-01-05 |
|
| PDBID: | 8rma | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmb | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase (R65S+T188D) double mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vin | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Superfolder Green Fluorescent Protein with 2-cyano-L-phenylalanine at the chromophore (position 66) | | Authors: | Kirsh, J.M., Bagheri, N., Boxer, S.G. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of heparosan synthase 2 from Pasteurella multocida with polysaccharide in the GlcNAc-T active site | | Authors: | Krahn, J.M., Pedersen, L.C., Liu, J., Stancanelli, E., Borgnia, M., Vivarette, E. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vix | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FBF-2 RBD in complex with gld-1 FBEa* RNA | | Authors: | Qiu, C., Hall, T.M.T. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viy | | Status: | HPUB -- hold until publication | | Title: | 15-Lipoxygenase-2 V427L | | Authors: | Gilbert, N.C., Offenbacher, A.R., Ohler, A.R.L. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vio | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vip | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vir | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vit | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal domain of fatty acid kinase A (FakA) from Staphylococcus aureus (Mg and ADP) | | Authors: | Lovell, S., Kashipathy, M.M., Battaile, K.P., Bose, J.L. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vj0 | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Trp161Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
