| PDBID: | 8vjx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vkb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vka | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dehaloperoxidase A in complex with substrate 4-nitrophenol | | Authors: | Aktar, M.S., de Serrano, V.S., Ghiladi, R.A., Franzen, S. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vkd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dehaloperoxidase A in complex with substrate 4-nitrocatechol | | Authors: | Aktar, M.S., de Serrano, V.S., Ghiladi, R.A., Franzen, S. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 | | Sequence: | >Entity 1
LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH
>Entity 2
AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
>Entity 3
KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHHHH
>Entity 4
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH
|
|
| PDBID: | 8xrl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xrn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xrg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xri | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xrf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xrh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xrk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xro | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-01-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8xrm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xrj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8vjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8vjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8vjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8xr7 | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xr8 | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xrc | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
