| PDBID: | 9gbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gc0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 9gbs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG18 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gby | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-07-31 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
| PDBID: | 9gbh | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND1 | | Authors: | Schaefer, M., Fuerstner, C., Ackerstaff, J., Meier, H., Straub, A., Mittendorf, J., Schamberger, J., Boerngen, K., Joerissen, H., Zubow, D., Zimmermann, K., Tersteegen, A., Geiss, V., Hartmann, E., Albrecht-Kuepper, B., Dorleans-Juste, P., Lapointe, C., Vincent, L., Heitmeier, S., Tinel, H. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG15 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz8 | | Status: | HPUB -- hold until publication | | Title: | fungal unspecific peroxygenase from Thielavia terrestris | | Authors: | Lai, M.Y., Yu, H.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | dmCTPS tetramer with dATP dUTP dGTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Focus refinement dmCTPS bound with dATP dUTP dGTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz3 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iym | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iys | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
