| PDBID: | 8whn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whg | | Status: | HPUB -- hold until publication | | Title: | imine reductase mutant - M3 | | Authors: | Zhu, X.X., Chen, X.R., Zheng, G.W. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ELKS2/LL5beta complex | | Authors: | Jia, X., Wei, Z. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8who | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH20541 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH201042 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21398 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 | | Sequence: | >Entity 1
GSHMVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG
|
|
| PDBID: | 8wh1 | | Status: | PROC -- to be processed | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8qmd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8qmj | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with hexa-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ube | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
