| PDBID: | 8rch | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, overall refinement | | Authors: | Anandapadamanaban, M., Hay, I.M., Perisic, O., Williams, R.L. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 8rci | | Status: | HPUB -- hold until publication | | Title: | Human p53 DNA-binding domain bound to DARPin C10 | | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rc6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of hexameric BTB domain of Drosophila CG6765 protein | | Authors: | Bonchuk, A.N., Naschberger, A., Baradaran, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
AENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT
|
|
| PDBID: | 8rce | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR alfa Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
HHHHHHSSGLVPRGSHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
| PDBID: | 8rc5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rcf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rck | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, Focused on one protomer copy. | | Authors: | Anandapadamanaban, M., Hay, I.M., Perisic, O., Williams, R.L. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 8rcn | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, Focused region of mTOR and RAPTOR on one protomer copy. | | Authors: | Anandapadamanaban, M., Hay, I.M., Perisic, O., Williams, R.L. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 8rcd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v8t | | Status: | HPUB -- hold until publication | | Title: | Asymmetrical subunit from a Drp1 lattice on PA nanotubes | | Authors: | Rochon, K., Peng, R., Stagg, S.M., Mears, J.A. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v8s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v90 | | Status: | HPUB -- hold until publication | | Title: | TtgR variant 3A7 with naltrexone | | Authors: | Acheson, J.F., Lee, D., Ramen, S. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xb6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Portal-vertex of SH-Ab15497 in C1 symmetry | | Authors: | Lin, J., Zhao, S.W. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xan | | Status: | HPUB -- hold until publication | | Title: | Major tail protein of SH-Ab15497 | | Authors: | Lin, J., Zhao, S.W. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xb1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FLT3 in complex with a Pyrazinamide Macrocycle derivative | | Authors: | Guo, M., Chen, Y. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xao | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xap | | Status: | HPUB -- hold until publication | | Title: | Thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xaq | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xaz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xb5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Portal protein of SH-Ab15497 | | Authors: | Lin, J., Zhao, S.W. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rby | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc3 | | Status: | HPUB -- hold until publication | | Title: | DNA bound type IV-A1 CRISPR effector complex from P. oleovorans | | Authors: | Miksys, A., Cepaite, R., Malinauskaite, L., Pausch, P. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8v8q | | Status: | HPUB -- hold until publication | | Title: | HUMAN LEUKOCYTE ANTIGEN B*07:02 IN COMPLEX WITH MERS-COV EPITOPE N95-103 (A95S mutant) | | Authors: | Oltean, N., Nyovanie, S., Hashem, A., Patskovska, L., Patskovsky, Y., Krogsgaard, M. | | Deposition date: | 2023-12-05 |
|
