| PDBID: | 8urg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8ura | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Corynebacterium ulcerans endo-beta-N-acetylglucosaminidase catalytically inactive CU43 D187A-E189A at 2.6 A resolution (space group P21) | | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8urc | | Status: | HPUB -- hold until publication | | Title: | Bacillus niacini flavin monooxygenase | | Authors: | Richardson, B.C., French, J.B. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8urd | | Status: | HPUB -- hold until publication | | Title: | Bacillus niacini flavin monooxygenase with bound (2,6)DHP | | Authors: | Richardson, B.C., French, J.B. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8ure | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8ur8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM reconstruction of Staphylococcus aureus oleate hydratase (OhyA) dimer of dimers | | Authors: | Oldham, M.L., Qayyum, M.Z. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of (S)-DHPS dehydrogenase HpsP from Dinoroseobacter shibae DFL 12 | | Authors: | Le, L., Kai, T. | | Deposition date: | 2023-10-25 | | Sequence: | >Entity 1
HHHHHHSSGGMKALVYTGVAQLAFRDVPEPVPAAGDHLIRIDSVGICGSDMHAYLGHDDRRPAPLILGHEGAGVIIGGPRDGERVTINPLVTCGTCPACVSGRDNLCATRQIISMPPRDGAFAQYVAMPARNLVTVPDDVPLEKAALAEPVAVSWHAVRLGLASMADARRDSALVIGGGAIGVAAAISLQAQGVADVTLVEPNAMRREYLARDANYTIATPEQVAGRVFDITVDGVGYDATRAAASAATRPGGLLLHIGLGGGSAGLDIRRITLQEITVIGTYTYTAQDFRDTCAAMFDGRLGGLDWTESRPLSAGADAFADIRAGRVPAPKIILKP
>Entity 2
HHHHHSSGGMKALVYTGVAQLAFRDVPEPVPAAGDHLIRIDSVGICGSDMHAYLGHDDRRPAPLILGHEGAGVIIGGPRDGERVTINPLVTCGTCPACVSGRDNLCATRQIISMPPRDGAFAQYVAMPARNLVTVPDDVPLEKAALAEPVAVSWHAVRLGLASMADARRDSALVIGGGAIGVAAAISLQAQGVADVTLVEPNAMRREYLARDANYTIATPEQVAGRVFDITVDGVGYDATRAAASAATRPGGLLLHIGLGGGSAGLDIRRITLQEITVIGTYTYTAQDFRDTCAAMFDGRLGGLDWTESRPLSAGADAFADIRAGRVPAPKIILKP
>Entity 3
GGMKALVYTGVAQLAFRDVPEPVPAAGDHLIRIDSVGICGSDMHAYLGHDDRRPAPLILGHEGAGVIIGGPRDGERVTINPLVTCGTCPACVSGRDNLCATRQIISMPPRDGAFAQYVAMPARNLVTVPDDVPLEKAALAEPVAVSWHAVRLGLASMADARRDSALVIGGGAIGVAAAISLQAQGVADVTLVEPNAMRREYLARDANYTIATPEQVAGRVFDITVDGVGYDATRAAASAATRPGGLLLHIGLGGGSAGLDIRRITLQEITVIGTYTYTAQDFRDTCAAMFDGRLGGLDWTESRPLSAGADAFADIRAGRVPAPKIILKP
|
|
| PDBID: | 8wwe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of (R)-DHPS dehydrogenase HpsN from Ruegeria pomeroyi DSS-3 | | Authors: | Le, L., Kai, T. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8ww6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8ww7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8ww8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8ww9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8wwa | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8wwc | | Status: | HPUB -- hold until publication | | Title: | De novo design binder of HRAS -120-4 | | Authors: | Wang, L., Wang, S., Liu, Y. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwg | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 complex with NAD | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qxg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8qxc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
